Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Mohawk homeobox Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen Mohawk homeobox
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Applications Western Blot, Immunohistochemistry
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126796
View Documents
Novus Biologicals
NBP31094825UL
25 μg
Each for $106.19
Add to cart
 
NB126795
View Documents
Novus Biologicals
NBP310948100UL
100 μg
Each for $320.71
Add to cart
 
Description

Description

Mohawk homeobox Polyclonal antibody specifically detects Mohawk homeobox in Human samples. It is validated for Western Blot, Immunohistochemistry
Specifications

Specifications

Mohawk homeobox
Western Blot, Immunohistochemistry
Purified
RUO
PBS buffer, 2% sucrose
283078
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml, Immunohistochemistry
Unconjugated
Rabbit
Human
C10orf48, homeobox protein Mohawk, IFRX, Iroquois family related homeodomain protein, iroquois homeobox protein-like 1, IRXL1chromosome 10 open reading frame 48, MGC39616, mohawk homeobox
The immunogen is a synthetic peptide directed towards the middle region of human Mohawk homeobox (NP_775847). Peptide sequence IKSENSVIKAGVRPESRASEDYVAPPKYKSSLLNRYLNDSLRHVMATNTT
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit