Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Mouse Adipoq (Q60994, 21 a.a. - 247 a.a.) Partial Recombinant Protein with His tag expressed in Hi-5 cells

Used for Func, SDS-PAGE

Manufacturer:  Abnova™ P5954

Catalog No. 89-932-714


Add to cart

Description

Description

Sequence: RGHHHHHHHHVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
Specifications

Specifications

Insect cell (Hi-5) expression system
Functional Study, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Lyophilized
35.0kDa
Insect cell (Hi-5) expression system
25 ug
Store at -20°C. Aliquot to avoid repeated freezing and thawing.
<0.1ng/μg of protein (<1 EU/μg).
Adipoq
Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Mouse ;Mouse
Yes
Q60994
Lyophilized
11450
Adipoq (Mouse) Recombinant Protein
0.95
RGHHHHHHHHVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
RUO
30kDa/APN/Acdc/Acrp30/GBP28/adipo/apM1
Adipoq
Determined by a cytotoxic assay using M1 cells. The ED50 for this effect is 4.0-6.0μg/ml.
Insect
His
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit