Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CSE1L (M05A), Mouse anti-Human, Clone: 3F8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CSE1L.

Manufacturer:  Abnova Corporation H00001434M05A

Catalog No. 89-104-335


Add to cart

Description

Description

Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation. [provided by RefSeq

Sequence: LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAARVTLL
Specifications

Specifications

CSE1L
Monoclonal
Unconjugated
ascites with no preservative
NM_001316
CAS/CSE1/MGC117283/MGC130036/MGC130037/XPO2
Mouse
IgG1 Kappa
RUO
Antibody
Monoclonal
Human
ELISA, Western Blot
3F8
Mouse monoclonal antibody raised against a partial recombinant CSE1L.
CSE1L
Ascites
CSE1L
CSE1L (NP_001307,872 a.a. ∽ 971 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
200 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
1434
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit