Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Mouse anti-DOG1/TMEM16A, Clone: DOG-1.1, Azide Free, Novus Biologicals™

Mouse Monoclonal Antibody

$366.50

Specifications

Antigen DOG1/TMEM16A
Clone DOG-1.1
Concentration 1.0 mg/mL
Immunogen A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQL-LETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein.
Gene Accession No. Q5XXA6
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP23460601
View Documents
Novus Biologicals
NBP2346060.1 MG
0.1 mg
Each for $366.50
Add to cart
 
NBP23460602
View Documents
Novus Biologicals
NBP2346060.2 MG
0.2 mg This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

DOG1/TMEM16A Monoclonal antibody specifically detects DOG1/TMEM16A in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.
Specifications

Specifications

DOG1/TMEM16A
1.0 mg/mL
Q5XXA6
10mM PBS - BSA free with No Preservative
Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.
Primary
Mouse
Unconjugated
Protein A or G purified
Western Blot, ELISA, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
DOG-1.1
A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQL-LETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein.
55107
Protein A purified
Monoclonal
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
IgG1 Kappa
Purified
RUO
SDS
Product Certifications

For Research Use Only

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit