Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ELF4, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ELF4.

Manufacturer:  Abnova Corporation H00002000A01

Catalog No. 89-104-428


Add to cart

Description

Description

ELF4 is a member of the ETS (see MIM 164720) gene family of transcription factors (Aryee et al., 1998 [PubMed 9524226]). ELF4 is involved in inducing cell cycle arrest in naive CD8+ T cells (Yamada et al., 2009 [PubMed 19412182]).[supplied by OMIM

Sequence: IAAFIRTSGTTAAPRVKEGPLRSSSYVQGMVTGAPMEGLLVPEETLRELLRDQAHLQPLPTQVVSRGSHNPSLLGNQTLSPPSRPTVGLTPV
Specifications

Specifications

ELF4
Unconjugated
50% glycerol
NM_001421
ELFR/MEF
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant ELF4.
ELF4
Antisera
ELF4
ELF4 (NP_001412, 521 a.a. to 612 a.a) partial recombinant protein with GST tag.
RUO
Primary
2000
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only