Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Mouse anti-ERp57/PDIA3, Clone: CL2444, Novus Biologicals™

Mouse Monoclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP236765

Catalog No. NBP236765


Add to cart

Description

Description

ERp57/PDIA3 Monoclonal antibody specifically detects ERp57/PDIA3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.
Specifications

Specifications

ERp57/PDIA3
CL2444
Western Blot 1:500-1:1000, Immunohistochemistry 1:5000-1:10000, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Knockdown Validated
G5EA52
Disulfide isomerase ER-60, EC 5.3.4.1, endoplasmic reticulum P58, Endoplasmic reticulum resident protein 57, Endoplasmic reticulum resident protein 60, ER protein 60, ER60, ERP57, ERp5758 kDa glucose-regulated protein, ERP60, ERp6058 kDa microsomal protein, ERp61, glucose regulated protein, 58kDa, GRP57, GRP58ER protein 57, HsT17083, P58, phospholipase C-alpha, PI-PLC, protein disulfide isomerase family A, member 3, protein disulfide isomerase-associated 3, protein disulfide-isomerase A3
Mouse
IgG1
0.1 ml
Cellular Markers, ER Markers, Membrane Trafficking and Chaperones
Primary
2923
Protein A purified
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Purified
PDIA3
This antibody was developed against Recombinant Protein corresponding to amino acids:PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK
Protein A purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Monoclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only