Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LASS4, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant LASS4.

Supplier: Abnova Corporation H00079603A01

Catalog No. 89-107-328

Description

Sequence: ERFIGLPLSRWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRRRRNQDRPQLTKKFCEASWR

Specifications

Antigen	LASS4
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a partial recombinant LASS4.
Gene	LASS4
Gene Alias	CerS4/FLJ12089/Trh1
Host Species	Mouse
Quantity	50 μL
Primary or Secondary	Primary
Target Species	Human
Form	Antisera

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	NM_024552
Gene Symbols	LASS4
Immunogen	LASS4 (NP_078828, 57 a.a. ∽ 139 a.a) partial recombinant protein with GST tag.
Regulatory Status	RUO
Gene ID (Entrez)	79603
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

LASS4, Mouse, Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions