Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Mouse anti-MEKK1, Clone: 2F6, Novus Biologicals™

Mouse Monoclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP2444050.02MG

 View more versions of this product

Catalog No. NBP24440500


Add to cart

Description

Description

Ensure accurate, reproducible results in Western Blot, Flow Cytometry, Immunohistochemistry (Paraffin), Immunofluorescence

MEKK1 Monoclonal antibody specifically detects MEKK1 in Human samples. It is validated for Flow Cytometry, Immunohistochemistry-Paraffin, Immunofluorescence.
Specifications

Specifications

MEKK1
2F6
Unconjugated
10mM PBS and 0.05% BSA with 0.05% Sodium Azide
Purified
MAP3K1
Partial recombinant MAP3K1 (aa1211-1310) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
Protein A or G purified
RUO
Store at 4C.
Monoclonal
Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NF B pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.
Flow Cytometry, Immunohistochemistry (Paraffin), Immunofluorescence
0.2mg/mL
Flow Cytometry 0.5 - 1 ug/million cells in 0.1 ml, Immunohistochemistry-Paraffin 0.5 - 1.0 ug/ml, Immunofluorescence 1 - 2 ug/ml
Q13233
MAPK/ERK kinase kinase 1, MAPKKK1MAP/ERK kinase kinase 1, MEK kinase 1, MEKK1EC 2.7.11.25, MEKKMEKK 1, mitogen-activated protein kinase kinase kinase 1
Mouse
IgG2a Kappa
0.02 mg
Angiogenesis, Breast Cancer, Cancer, Lipid and Metabolism, MAP Kinase Signaling, mTOR Pathway, Protein Kinase, Signal Transduction, Tyrosine Kinases
Primary
4214
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only