NFKBIL2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant NFKBIL2.

Supplier:  Abnova Corporation H00004796A01

Catalog No. 89-104-994

Description

The protein encoded by this gene is thought to be a negative regulator of NF-kappa-B mediated transcription. The encoded protein may bind NF-kappa-B complexes and trap them in the cytoplasm, preventing them from entering the nucleus and interacting with the DNA. Phosphorylation of this protein targets it for degradation by the ubiquitination pathway, which frees the NF-kappa-B complexes to enter the nucleus. [provided by RefSeq

Sequence: MRTRLYLNLGLTFESLQQTALCNDYFRKSIFLAEQNHLYEDLFRARYNLGTIHWRAGQHSQAMRCLEGARECAHTMRKRFMESECCVVIAQVLQDLG

Specifications

• Antigen: NFKBIL2
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant NFKBIL2.
• Gene: NFKBIL2
• Gene Alias: FLJ40087/IKBR
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_013432
• Gene Symbols: NFKBIL2
• Immunogen: NFKBIL2 (NP_038460, 1 a.a. ∽ 97 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 4796
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only