Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PARVG, Mouse, Clone: 4E1, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant PARVG.

Manufacturer:  Abnova Corporation H00064098M01A

Catalog No. 89-107-268


Add to cart

Description

Description

Members of the parvin family, including PARVG, are actin-binding proteins associated with focal contacts.[supplied by OMIM

Sequence: MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFEELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAALKLEAEDIALTATSQKHKLTVVLEAVNRSLQLEEWQAKWSVESIFNKDLLSTLHLLVALAKRFQPDLSLPTNVQVEVITIESTKSGLKSEKLVEQLTEYSTDKDEPPKDVFDELFKLAPEKVNAVKEAIVNFVNQKLDRLGLSVQNLDTQFADGVILLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALELLKDEGLLSCPVSPEDIVNKDAKSTLRVLYGLFCKHTQKAHRDRTPHGAPN
Specifications

Specifications

PARVG
Monoclonal
Unconjugated
ascites with no preservative
BC034406
PARVG
PARVG (AAH34406,1 a.a. ∽ 331 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
200 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
64098
ELISA, Western Blot
4E1
Mouse monoclonal antibody raised against a full-length recombinant PARVG.
PARVG
Ascites
Mouse
IgG1 Kappa
RUO
Antibody
Monoclonal
Human
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit