Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Mouse anti-PMP70, Clone: CL2524, Novus Biologicals™

Mouse Monoclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP236770

Catalog No. NBP236770


Add to cart

Description

Description

PMP70 Monoclonal antibody specifically detects PMP70 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications

Specifications

PMP70
CL2524
Immunohistochemistry 1:200-1:500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
P28288
70 kDa peroxisomal membrane protein, ABC43, ATP-binding cassette, sub-family D (ALD), member 3, peroxisomal membrane protein 1 (70kD, Zellweger syndrome), Peroxisomal membrane protein-1 (70kD), PMP70ATP-binding cassette sub-family D member 3, PXMP1dJ824O18.1 (ATP-binding cassette, sub-family D (ALD), member 3 (PMP70, PXMP1)), ZWS2
Mouse
IgG1
0.1 ml
ABC Transporters, Cellular Markers, Lipid and Metabolism, Neuroscience, Peroxisome Markers, Signal Transduction
Primary
5825
Protein A purified
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Purified
ABCD3
This antibody was developed against Recombinant Protein corresponding to amino acids:MVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLATPNGDVLIRDLNFEVRSGANVLICGP
Protein A purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Monoclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only