Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

POLR2D, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length recombinant POLR2D.

Manufacturer:  Abnova Corporation H00005433A01

Catalog No. 89-105-162


Add to cart

Description

Description

This gene encodes the fourth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit is associated with the polymerase under suboptimal growth conditions and may have a stress protective role. A sequence for a ribosomal pseudogene is contained within the 3' untranslated region of the transcript from this gene. [provided by RefSeq

Sequence: MAAGGSDPRAGDVEEDASQLIFPKGFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
Specifications

Specifications

POLR2D
Unconjugated
50% glycerol
BC017205
HSRBP4/HSRPB4/RBP4
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a full-length recombinant POLR2D.
POLR2D
Antisera
POLR2D
POLR2D (AAH17205, 1 a.a. ∽ 142 a.a) full-length recombinant protein with GST tag.
RUO
Primary
5433
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only