SLCO1B1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SLCO1B1.

Supplier:  Abnova Corporation H00010599A01

Catalog No. 89-106-365

Description

This gene encodes a liver-specific member of the organic anion transporter family. The encoded protein is a transmembrane receptor that mediates the sodium-independent uptake of numerous endogenous compounds including bilirubin, 17-beta-glucuronosyl estradiol and leukotriene C4. This protein is also involved in the removal of drug compounds such as statins, bromosulfophthalein and rifampin from the blood into the hepatocytes. Polymorphisms in the gene encoding this protein are associated with impaired transporter function. [provided by RefSeq

Sequence: YISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFFVAIQVLNLFFSALGGTSHVMLIVKIVQPELKSL

Specifications

• Antigen: SLCO1B1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant SLCO1B1.
• Gene: SLCO1B1
• Gene Alias: LST-1/LST1/MGC133282/OATP-C/OATP1B1/OATP2/OATPC/SLC21A6
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_006446
• Gene Symbols: SLCO1B1
• Immunogen: SLCO1B1 (NP_006437, 481 a.a. ∽ 570 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 10599
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only