HIV-1 Gag p24 Antibody (7F4) - BSA Free, Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP241339

Catalog No. NBP241339

Description

HIV-1 Gag p24 Monoclonal antibody specifically detects HIV-1 Gag p24 in Virus samples. It is validated for Western Blot, ELISA.

Specifications

• Antigen: HIV-1 Gag p24
• Classification: Monoclonal
• Concentration: 1 mg/mL
• Dilution: Western Blot 0.2-0.5 μg/mL, ELISA 0.2- 0.5 μg/mL
• Gene Alias: Capsid protein p24, Human immunodeficiency virus 1, Human immunodeficiency virus type 1 p24
• Host Species: Mouse
• Molecular Weight of Antigen: 24, 41, 55 kDa
• Quantity: 0.1 mg
• Primary or Secondary: Secondary
• Test Specificity: By Western blot, anti-HIV-1 Gag p24 antibody detects a ∼24 kDa, a ∼41 kDa, and a ∼55 kDa protein, corresponding to HIV-1 Gag p24 and to its precursors p41 and p55, respectively, in HIV-1 samples.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG1

• Applications: Western Blot, ELISA
• Clone: 7F4
• Conjugate: Unconjugated
• Formulation: PBS with 0.02% Sodium Azide
• Gene Symbols: gag
• Immunogen: Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein. Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 155030
• Target Species: Virus
• Form: Purified