Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Mouse Csf3 (P09920) Recombinant Protein

Used for Func, SDS-PAGE

Manufacturer:  Abnova™ P4594

Catalog No. 89-940-713


Add to cart

Description

Description

Sequence: MVPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
Specifications

Specifications

P09920
Lyophilized
12985
Csf3 (Mouse) Recombinant Protein
1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
MVPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
RUO
Csfg|G-CSF|MGI-IG
Csf3
The activity is determined by the dose-dependent proliferation of mouse M-NFS-60 cells. The expected ED50 for this effect is 8-12pg/mL.
Yes
Functional Study, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Lyophilized
19kDa
Escherichia coli expression system
10 ug
Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing.
<0.1 EU/μg
Csf3
Escherichia coli expression system
Escherichia coli
None
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit