Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Mouse Cxcl1 (P12850) Recombinant Protein

Used for Func, SDS-PAGE

Manufacturer:  Abnova™ P4603

Catalog No. 89-941-032


Add to cart

Description

Description

Sequence: APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Specifications

Specifications

P12850
Lyophilized
14825
Cxcl1 (Mouse) Recombinant Protein
1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
RUO
Fsp|Gro1|KC|Mgsa|N51|Scyb1|gro
Cxcl1
The activity is determined by the ability to chemoattract human neutrophils cells and is detectable starting at 10ng/mL.
Yes
Functional Study, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Lyophilized
7.8kDa
Escherichia coli expression system
20 ug
Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing.
<0.1 EU/μg
Cxcl1
Escherichia coli expression system
Escherichia coli
None
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit