Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Mouse Fgf1 (NP_034327, 16 a.a. - 155 a.a.) Partial Recombinant Protein with His-tag

Name: Abnova&trade; Mouse Fgf1 (NP_034327, 16 a.a. - 155 a.a.) Partial Recombinant Protein with His-tag
Brand: Abnova&trade;
SKU: 89-944-432
Price: 578.00 USD

Used for Func, SDS-PAGE

Supplier: Abnova™ P4536

Catalog No. 89-944-432

$578.00 / Each of 1

Qty

Add to Cart

Description

Sequence: MGSSHHHHHHSSGLVPRGSHMFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Specifications

Accession Number	NP_034327
For Use With (Application)	Functional Study, SDS-PAGE
Gene ID (Entrez)	14164
Name	Fgf1 (Mouse) Recombinant Protein
Quality Control Testing	15% SDS-PAGE Stained with Coomassie Blue
Immunogen	MGSSHHHHHHSSGLVPRGSHMFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Regulatory Status	RUO
Common Name	Fgf1
Species	E. coli
Protein Tag	His
Form	Liquid

Concentration	1mg/mL
Formulation	Liquid
Molecular Weight (g/mol)	18kDa
Preparation Method	Escherichia coli expression system
Quantity	100 ug
Storage Requirements	Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	Dffrx/Fam/Fgf-1/Fgfa
Gene Symbol	Fgf1
Recombinant	Recombinant
Expression System	Escherichia coli expression system
Purity or Quality Grade	>90% by SDS - PAGE

Product Suggestions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

Full Name:

Email Address:*

User Name:

Telephone Number:

What type of issue did you experience with the content on the page?*

Please provide a detailed description of the issue or request*

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Spot an opportunity for improvement?

Provide Content Correction

Abnova™ Mouse Fgf1 (NP_034327, 16 a.a. - 155 a.a.) Partial Recombinant Protein with His-tag

Description

Specifications

Product Suggestions

Documents

Promotions