Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Mouse Il12a (P43431) Full-length Recombinant Protein expressed in CHO cell

Used for Func, SDS-PAGE

Manufacturer:  Abnova™ P6085

Catalog No. 89-948-621


Add to cart

Description

Description

Sequence: p35Subunit:
Specifications

Specifications

P43431
Functional Study, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Lyophilized
Il12a (Mouse) Recombinant Protein
0.98
p35Subunit: RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA p40Subunit: MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
RUO
IL-12p35|Il-12a|Ll12a|MGC151228|MGC151232|p35
Il12a
Mouse ;Mouse
Yes
CHO cell expression system
Lyophilized
16159
CHO cell expression system
10 ug
Store at -20°C. Reconstitute in 1x PBS, pH 7.2-7.4 to a concentration of 0.1-1.0 mg/ml. Do not vortex. For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20°C to -80°C.
<0.1ng/μg (<1 EU/μg)
Il12a
Assay 1:
The ED50 determined by the stimulation of IFN-gamma production with murine splenocytes co-stimulated with IL-18 is < 0.1 ng/ml, corresponding to a specific activity of > 1 x 107 units/mg.
Assay 2:
The activity is determined by its ability to stimulate the proliferation of 2D6 cells. The expected ED50 is < 0.1ng/ml, corresponding to a specific activity of > 1 x 107 units/mg.
Hamster
None
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit