Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Mouse Il18 (NP_032386, 36 a.a. - 192 a.a.) Partial Recombinant Protein with His tag

Used for SDS-PAGE

Manufacturer:  Abnova™ P4335

Catalog No. 89-948-713


Add to cart

Description

Description

Sequence: MGSSHHHHHHSSGLVPRGSHMNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
Specifications

Specifications

Escherichia coli expression system
1 mg/mL
Liquid
16173
Il18 (Mouse) Recombinant Protein
Conventional Chromatography
15% SDS-PAGE Stained with Coomassie Blue
MGSSHHHHHHSSGLVPRGSHMNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
RUO
Igif|Il-18
Il18
Yes
NP_032386
Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Liquid
20.4kDa
Escherichia coli expression system
>90% by SDS-PAGE
100 ug
Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing.
<1.0 EU/μg of protein (determined by LAL method)
Il18
Escherichia coli
His
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit