Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Mouse Il28a (Q4VK74) Partial Recombinant Protein

Used for Func, SDS-PAGE

Manufacturer:  Abnova™ P6007

Catalog No. 89-948-861


Add to cart

Description

Description

Sequence: MDPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFRLLTRDLKCVASGDQCV
Specifications

Specifications

Q4VK74
Functional Study, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Lyophilized
25.0kDa
Escherichia coli expression system
20 ug
Store at -20°C. Aliquot to avoid repeated freezing and thawing.
<0.1ng/μg (<1 EU/μg).
Il28a
Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Mouse ;Mouse
Yes
Escherichia coli expression system
Lyophilized
330496
Il28a (Mouse) Recombinant Protein
0.98
MDPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFRLLTRDLKCVASGDQCV
RUO
EG330496|Ifnl2
Il28a
Determined by its ability to activate STAT following receptor-ligand interaction.
Escherichia coli
None
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit