MOV10 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15710820UL

Catalog No. NBP15710820

Description

MOV10 Polyclonal specifically detects MOV10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MOV10
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q9HCE1
• Gene Symbols: MOV10
• Immunogen: Synthetic peptides corresponding to MOV10(Mov10, Moloney leukemia virus 10, homolog (mouse)) The peptide sequence was selected from the C terminal of MOV10. Peptide sequence AKLDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWR.
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp667O1423, EC 3.6.1, EC 3.6.4.13, FLJ32791, KIAA1631mouse) homolog, Mov10, Moloney leukemia virus 10, homolog (mouse)
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4343
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG