Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MPST Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15473420UL

 View more versions of this product

Catalog No. NBP15473420


Add to cart

Description

Description

MPST Polyclonal antibody specifically detects Antigen in Human, Mouse, Rat samples. It is validated for Western Blotting.
Specifications

Specifications

MPST
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
MPST
Synthetic peptides corresponding to MPST(mercaptopyruvate sulfurtransferase) The peptide sequence was selected from the middle region of MPST. Peptide sequence DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT.
33 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human, Mouse, Rat
Western Blot
Western Blot 0.2-1 ug/ml
P25325
mercaptopyruvate sulfurtransferase, MGC24539, MSThuman liver rhodanese, TST2EC 2.8.1.2,3-mercaptopyruvate sulfurtransferase
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
4357
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit