Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MRM1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | MRM1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157367
|
Novus Biologicals
NBP157367 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
MRM1 Polyclonal specifically detects MRM1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| MRM1 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Q6IN84-2 | |
| 79922 | |
| Synthetic peptides corresponding to MRM1 (mitochondrial rRNA methyltransferase 1 homolog (S. cerevisiae)) The peptide sequence was selected from the C terminal of MRM1. Peptide sequence GTVGCPSTEDPQSSEIPIMSCLEFLWERPTLLVLGNEGSGLSQEVQASCQ. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EC 2.1.1.-, FLJ22578, Mitochondrial large ribosomal RNA ribose methylase, mitochondrial rRNA methyltransferase 1 homolog (S. cerevisiae), rRNA methyltransferase 1, mitochondrial | |
| MRM1 | |
| IgG | |
| Protein A purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title