Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MRP1 Antibody (IU5C1), DyLight 550, Novus Biologicals™
Mouse Monoclonal Antibody
Supplier: Novus Biologicals NB11057131R
Description
MRP1 Monoclonal antibody specifically detects MRP1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
MRP1 | |
Monoclonal | |
DyLight 550 | |
ABC29, ABCC, ATP-binding cassette sub-family C member 1, ATP-binding cassette, sub-family C (CFTR/MRP), member 1, EC 3.6.3, EC 3.6.3.44, GS-X, Leukotriene C(4) transporter, LTC4 transporter, MRP1DKFZp781G125, MRPDKFZp686N04233, multidrug resistance associated protein 1, multidrug resistance protein, multidrug resistance-associated protein 1, multiple drug resistance protein 1, multiple drug resistance-associated protein | |
A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot# P33527] | |
0.1 mL | |
ABC Transporters, Amino Acids Drugs and other small molecules, Cancer, Lipid and Metabolism, Plasma Membrane Markers, Signal Transduction | |
4363 | |
Store at 4°C in the dark. | |
IgG1 |
Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
IU5C1 | |
50mM Sodium Borate | |
Mouse | |
Protein G purified | |
RUO | |
Primary | |
Human, Mouse | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Product Content Correction