MRPL48 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154676

Catalog No. NBP154676

Description

MRPL48 Polyclonal specifically detects MRPL48 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MRPL48
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96GC5
• Gene Symbols: MRPL48
• Immunogen: Synthetic peptides corresponding to MRPL48(mitochondrial ribosomal protein L48) The peptide sequence was selected from the middle region of MRPL48. Peptide sequence KKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYVHNLCNSLSIK.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51642
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 39S ribosomal protein L48, mitochondrial, CGI-118, FLJ17047, FLJ99260, HSPC290, L48MT, MGC13323, mitochondrial ribosomal protein L48, MRP-L48
• Host Species: Rabbit
• Molecular Weight of Antigen: 24 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Horse: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG