Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MRPL48 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | MRPL48 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154676
|
Novus Biologicals
NBP154676 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
MRPL48 Polyclonal specifically detects MRPL48 in Human samples. It is validated for Western Blot.Specifications
| MRPL48 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 39S ribosomal protein L48, mitochondrial, CGI-118, FLJ17047, FLJ99260, HSPC290, L48MT, MGC13323, mitochondrial ribosomal protein L48, MRP-L48 | |
| MRPL48 | |
| IgG | |
| Affinity Purified | |
| 24 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96GC5 | |
| 51642 | |
| Synthetic peptides corresponding to MRPL48(mitochondrial ribosomal protein L48) The peptide sequence was selected from the middle region of MRPL48. Peptide sequence KKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYVHNLCNSLSIK. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title