Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MRPS2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | MRPS2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154663
|
Novus Biologicals
NBP154663 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
MRPS2 Polyclonal specifically detects MRPS2 in Human samples. It is validated for Western Blot.Specifications
| MRPS2 | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 28S ribosomal protein S2, mitochondrial, CGI-91, mitochondrial 28S ribosomal protein S2, mitochondrial ribosomal protein S2, MRP-S2, S2mt | |
| MRPS2 | |
| IgG | |
| Affinity Purified | |
| 33 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Human | |
| Q9Y399 | |
| 51116 | |
| Synthetic peptides corresponding to MRPS2(mitochondrial ribosomal protein S2) The peptide sequence was selected from the N terminal of MRPS2. Peptide sequence MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIR. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title