Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MRS2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | MRS2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15961420
|
Novus Biologicals
NBP15961420UL |
20 μL |
Each for $152.22
|
|
NBP159614
|
Novus Biologicals
NBP159614 |
100 μL |
Each for $436.00
|
|
Description
MRS2 Polyclonal specifically detects MRS2 in Human samples. It is validated for Western Blot.Specifications
| MRS2 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| HPT, MGC78523, mitochondrial, MRS2 magnesium homeostasis factor homolog (S. cerevisiae), MRS2-like protein, MRS2-like, magnesium homeostasis factor, MRS2-like, magnesium homeostasis factor (S. cerevisiae) | |
| MRS2 | |
| IgG | |
| Affinity Purified | |
| 50 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9HD23 | |
| 57380 | |
| Synthetic peptides corresponding to MRS2L The peptide sequence was selected from the middle region of MRS2L. Peptide sequence LDALVDPKHSSVDRSKLHILLQNGKSLSELETDIKIFKESILEILDEEEL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title