Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MS4A6E Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen MS4A6E
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB124052
View Documents
Novus Biologicals
NBP30957525UL
25 μg
Each for $106.19
Add to cart
 
NB124051
View Documents
Novus Biologicals
NBP309575100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

MS4A6E Polyclonal antibody specifically detects MS4A6E in Human samples. It is validated for Western Blot
Specifications

Specifications

MS4A6E
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
245802
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Human
membrane-spanning 4-domains subfamily A member 6E, membrane-spanning 4-domains, subfamily A, member 6E, MGC126832
The immunogen is a synthetic peptide directed towards the middle region of Human MS4A6E (NP_640342). Peptide sequence FILLSVNPAALNPASLQCKLDEKDIPTRLLLSYDYHSPYTMDCHRAKASL
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit