Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MSANTD3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19844120UL
Description
MSANTD3 Polyclonal specifically detects MSANTD3 in Human samples. It is validated for Western Blot.Specifications
MSANTD3 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_542386 | |
MSANTD3 | |
The immunogen for this antibody is C9orf30 - C-terminal region. Peptide sequence VRITANKNYRSKTSQEGALKKMHEEEHHQQMSILQLQLIQMNEVHVAKIQ. | |
Affinity Purified | |
RUO | |
91283 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
C9orf30, chromosome 9 open reading frame 30, FLJ34973, hypothetical protein LOC91283, L8, MGC17337, MSANTD3, Myb/SANT-like DNA-binding domain containing 3 | |
Rabbit | |
30 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title