Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
V alpha 24 J alpha 18 TCR Antibody (6B11) - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
$155.40 - $458.00
Specifications
| Antigen | MSANTD3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1984420
|
Novus Biologicals
NBP19844120UL |
20 μL |
Each for $155.40
|
|
|||||
|
NBP198441
|
Novus Biologicals
NBP198441 |
100 μL |
Each for $458.00
|
|
|||||
Description
MSANTD3 Polyclonal specifically detects MSANTD3 in Human samples. It is validated for Western Blot.Specifications
| MSANTD3 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| C9orf30, chromosome 9 open reading frame 30, FLJ34973, hypothetical protein LOC91283, L8, MGC17337, MSANTD3, Myb/SANT-like DNA-binding domain containing 3 | |
| MSANTD3 | |
| IgG | |
| Affinity Purified | |
| 30 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_542386 | |
| 91283 | |
| The immunogen for this antibody is C9orf30 - C-terminal region. Peptide sequence VRITANKNYRSKTSQEGALKKMHEEEHHQQMSILQLQLIQMNEVHVAKIQ. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title