Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MSH5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen MSH5
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP158154
View Documents
Novus Biologicals
NBP158154
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

MSH5 Polyclonal specifically detects MSH5 in Human samples. It is validated for Western Blot.
Specifications

Specifications

MSH5
Polyclonal
Rabbit
DNA Repair, Mismatch Repair
Q9UMP2
4439
Synthetic peptides corresponding to MSH5(mutS homolog 5 (E. coli)) The peptide sequence was selected from the N terminal of MSH5. Peptide sequence KQRLLSGNYSFIPDAMTATEKILFLSSIIPFDCLLTPPGDLRFTPIPLLI.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
Human
DKFZp434C1615, G7, hMSH5, MGC2939, mutS (E. coli) homolog 5, mutS homolog 5 (E. coli), mutS protein homolog 5, MUTSH5, NG23
MSH5
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit