Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MSL2L1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP152987

 View more versions of this product

Catalog No. NBP152987


Add to cart

Description

Description

MSL2L1 Polyclonal antibody specifically detects MSL2L1 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

MSL2L1
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
MSL2
Synthetic peptides corresponding to MSL2L1(male-specific lethal 2-like 1 (Drosophila)) The peptide sequence was selected from the N terminal of MSL2L1. Peptide sequence NPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLL.
Immunogen affinity purified
RUO
Primary
55167
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:100-1:2000
Q9HCI7
FLJ10546, KIAA1585FLJ54913, male-specific lethal 2 homolog, male-specific lethal 2 homolog (Drosophila), Male-specific lethal 2-like 1, male-specific lethal 2-like 1 (Drosophila), Male-specific lethal-2 homolog 1, MSL-2, MSL2L1, MSL2-like 1, PHNPCC4, PMS2, RING finger protein 184msl-2, RNF184
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Rat: 100%; Mouse: 100%; Human: 100%;.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit