Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MTCH1 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179197

 View more versions of this product

Catalog No. NBP179197


Add to Cart

Description

Description

MTCH1 Polyclonal specifically detects MTCH1 in Rat samples. It is validated for Western Blot.
Specifications

Specifications

MTCH1
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
cell proliferation-inducing protein 60, CGI-64, MGC131998, mitochondrial carrier homolog 1, mitochondrial carrier homolog 1 (C. elegans), Presenilin-associated protein, PSAPPIG60
Rabbit
Affinity purified
RUO
23787
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
0.5 mg/ml
Western Blot 1.0 ug/ml
NP_001094303
MTCH1
Synthetic peptide directed towards the middle region of human Mtch1The immunogen for this antibody is Mtch1. Peptide sequence MSNALSTVTRGSMKKVFPPDEIEQVSNKDDMKTSLKKVVKETSYEMMMQC.
100 μL
Primary
Expected identity based on immunogen sequence: Bovine: 100%; Guinea pig: 100%; Human: 100%; Pig: 100%; Rat: 100%; Canine: 92%; Mouse: 92%; Rabbit: 92%.
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
IgG
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit