Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MTCH1 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179197
Description
MTCH1 Polyclonal specifically detects MTCH1 in Rat samples. It is validated for Western Blot.Specifications
MTCH1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
NP_001094303 | |
MTCH1 | |
Synthetic peptide directed towards the middle region of human Mtch1The immunogen for this antibody is Mtch1. Peptide sequence MSNALSTVTRGSMKKVFPPDEIEQVSNKDDMKTSLKKVVKETSYEMMMQC. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Bovine: 100%; Guinea pig: 100%; Human: 100%; Pig: 100%; Rat: 100%; Canine: 92%; Mouse: 92%; Rabbit: 92%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
cell proliferation-inducing protein 60, CGI-64, MGC131998, mitochondrial carrier homolog 1, mitochondrial carrier homolog 1 (C. elegans), Presenilin-associated protein, PSAPPIG60 | |
Rabbit | |
Affinity Purified | |
RUO | |
23787 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title