Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MTCH1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | MTCH1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179197
|
Novus Biologicals
NBP179197 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
MTCH1 Polyclonal specifically detects MTCH1 in Rat samples. It is validated for Western Blot.Specifications
MTCH1 | |
Polyclonal | |
Rabbit | |
NP_001094303 | |
23787 | |
Synthetic peptide directed towards the middle region of human Mtch1The immunogen for this antibody is Mtch1. Peptide sequence MSNALSTVTRGSMKKVFPPDEIEQVSNKDDMKTSLKKVVKETSYEMMMQC. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
cell proliferation-inducing protein 60, CGI-64, MGC131998, mitochondrial carrier homolog 1, mitochondrial carrier homolog 1 (C. elegans), Presenilin-associated protein, PSAPPIG60 | |
MTCH1 | |
IgG |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title