Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MTGR1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP19161720UL

 View more versions of this product

Catalog No. NBP19161720


Add to cart

Description

Description

MTGR1 Polyclonal antibody specifically detects Antigen in Mouse samples. It is validated for Western Blotting.
Specifications

Specifications

MTGR1
Unconjugated
PBS & 2% Sucrose. with No Preservative
Affinity Purified
CBFA2T2
Synthetic peptide directed towards the middle region of mouse CBFA2T2H. Peptide sequence RRSMAVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDS.
Immunogen affinity purified
RUO
Primary
9139
Western Blot
Western Blot 1:1000
NP_766448
core-binding factor, runt domain, alpha subunit 2; translocated to, 2, EHTDKFZp313F2116, ETO homolog on chromosome 20, ETO homologous on chromosome 20, MTG8-like protein, MTG8-related protein 1, MTGR1p85, myeloid translocation gene-related protein 1, Myeloid translocation-related protein 1, protein CBFA2T2, ZMYND3
Rabbit
IgG
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Mouse
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit