Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MTHFSD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | MTHFSD |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MTHFSD Polyclonal specifically detects MTHFSD in Human samples. It is validated for Western Blot.Specifications
MTHFSD | |
Polyclonal | |
Rabbit | |
NP_073601 | |
64779 | |
Synthetic peptide directed towards the N terminal of human MTHFSD. Peptide sequence MEPRAGVSKQDIREQIWGYMESQNLADFPRPVHHRIPNFKGSYLACQNIK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ12998, FLJ13893, methenyltetrahydrofolate synthase domain-containing protein, methenyltetrahydrofolate synthetase domain containing, methenyltetrahydrofolate synthetase domain-containing protein, MGC138262, MGC138264, MGC177233 | |
MTHFSD | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title