Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MTMR1 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155486

 View more versions of this product

Catalog No. NBP155486


Add to Cart

Description

Description

MTMR1 Polyclonal specifically detects MTMR1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

MTMR1
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
EC 3.1.3, EC 3.1.3.-, EC 3.1.3.48, myotubularin related protein 1, myotubularin-related protein 1
Rabbit
73 kDa
100 μL
Primary
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
IgG
Western Blot
1 mg/ml
Western Blot 1.0 ug/ml
Q13613
MTMR1
Synthetic peptides corresponding to MTMR1(myotubularin related protein 1) The peptide sequence was selected from the C terminal of MTMR1. Peptide sequence KEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY.
Protein A purified
RUO
8776
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Purified
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit