MTMR1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155486

Catalog No. NBP155486

Description

MTMR1 Polyclonal specifically detects MTMR1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MTMR1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q13613
• Gene Symbols: MTMR1
• Immunogen: Synthetic peptides corresponding to MTMR1(myotubularin related protein 1) The peptide sequence was selected from the C terminal of MTMR1. Peptide sequence KEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8776
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.1.3, EC 3.1.3.-, EC 3.1.3.48, myotubularin related protein 1, myotubularin-related protein 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 73 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG