Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MTMR1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen MTMR1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP155486
View Documents
Novus Biologicals
NBP155486
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

MTMR1 Polyclonal specifically detects MTMR1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

MTMR1
Polyclonal
Purified
RUO
Q13613
8776
Synthetic peptides corresponding to MTMR1(myotubularin related protein 1) The peptide sequence was selected from the C terminal of MTMR1. Peptide sequence KEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
EC 3.1.3, EC 3.1.3.-, EC 3.1.3.48, myotubularin related protein 1, myotubularin-related protein 1
MTMR1
IgG
Protein A purified
73 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit