Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MTMR1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | MTMR1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155486
|
Novus Biologicals
NBP155486 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
MTMR1 Polyclonal specifically detects MTMR1 in Human samples. It is validated for Western Blot.Specifications
| MTMR1 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Q13613 | |
| 8776 | |
| Synthetic peptides corresponding to MTMR1(myotubularin related protein 1) The peptide sequence was selected from the C terminal of MTMR1. Peptide sequence KEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EC 3.1.3, EC 3.1.3.-, EC 3.1.3.48, myotubularin related protein 1, myotubularin-related protein 1 | |
| MTMR1 | |
| IgG | |
| Protein A purified | |
| 73 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title