Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MTMR15 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$104.00 - $345.50

Specifications

Antigen MTMR15
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB120132
View Documents
Novus Biologicals
NBP31099225UL
25 μg
Each for $104.00
Add to cart
 
NB120131
View Documents
Novus Biologicals
NBP310992100UL
100 μg
Each for $345.50
Add to cart
 
Description

Description

MTMR15 Polyclonal antibody specifically detects MTMR15 in Human samples. It is validated for Western Blot
Specifications

Specifications

MTMR15
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
22909
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Human
DKFZp451H236, EC 3.1.21.-, EC 3.1.4.1, FANCD2/FANCI-associated nuclease 1DKFZp686K16147, fanconi anemia associated nuclease 1, fanconi-associated nuclease 1, KIAA1018coiled-coil domain-containing protein MTMR15, MTMR15, myotubularin related protein 15, Myotubularin-related protein 15
The immunogen is a synthetic peptide directed towards the C terminal region of human MTMR15 (NP_001139568.1). Peptide sequence QVGLINSNVSMVDLTSVTLEDVTPKKSPPPKTNLTPGQSDSAKREVKQKI
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit