Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MUC12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP15971920UL
Description
MUC12 Polyclonal specifically detects MUC12 in Human samples. It is validated for Western Blot.Specifications
MUC12 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
MUC11, MUC-11, MUC-12, mucin 11, mucin 12, cell surface associated, mucin-11, mucin-12 | |
Rabbit | |
23 kDa | |
20 μL | |
Cancer, Tumor Suppressors | |
10071 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
MUC12 | |
Synthetic peptides corresponding to MUC12(mucin 12, cell surface associated) The peptide sequence was selected from the middle region of MUC12. Peptide sequence PSVLVGDSTPSPISSGSMETTALPGSTTKPGLSEKSTTFYSSPRSPDTTH. | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction