Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MURF2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | MURF2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155082
|
Novus Biologicals
NBP155082 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
MURF2 Polyclonal specifically detects MURF2 in Human samples. It is validated for Western Blot.Specifications
| MURF2 | |
| Polyclonal | |
| Rabbit | |
| Zinc Finger | |
| MuRF2, MURF-2, Muscle-specific RING finger protein 2, RING finger protein 29muscle specific ring finger 2, RNF29, tripartite motif containing 55, tripartite motif-containing 55, tripartite motif-containing protein 55 | |
| TRIM55 | |
| IgG | |
| Affinity Purified | |
| 27 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9BYV6 | |
| 84675 | |
| Synthetic peptide directed towards the middle region of human TRIM55 (NP_908975). Peptide sequence SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title