Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MURF2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen MURF2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP155082
View Documents
Novus Biologicals
NBP155082
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

MURF2 Polyclonal specifically detects MURF2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

MURF2
Polyclonal
Rabbit
Zinc Finger
MuRF2, MURF-2, Muscle-specific RING finger protein 2, RING finger protein 29muscle specific ring finger 2, RNF29, tripartite motif containing 55, tripartite motif-containing 55, tripartite motif-containing protein 55
TRIM55
IgG
Affinity Purified
27 kDa
Western Blot
Unconjugated
RUO
Q9BYV6
84675
Synthetic peptide directed towards the middle region of human TRIM55 (NP_908975). Peptide sequence SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit