Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MURF3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15289920UL
Description
MURF3 Polyclonal specifically detects MURF3 in Human samples. It is validated for Western Blot.Specifications
MURF3 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
MuRF, MuRF3, MURF-3, MURFtripartite motif-containing protein 54, Muscle-specific RING finger protein, Muscle-specific RING finger protein 3, RING finger protein 30muscle-specific RING-finger protein 3, RNF30, tripartite motif containing 54, tripartite motif-containing 54 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
TRIM54 | |
Synthetic peptides corresponding to TRIM54(tripartite motif-containing 54) The peptide sequence was selected from the N terminal of TRIM54. Peptide sequence NFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCA. | |
20 μL | |
Zinc Finger | |
57159 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction