MURF3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP152899

Catalog No. NBP152899

Description

MURF3 Polyclonal specifically detects MURF3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MURF3
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: MuRF, MuRF3, MURF-3, MURFtripartite motif-containing protein 54, Muscle-specific RING finger protein, Muscle-specific RING finger protein 3, RING finger protein 30muscle-specific RING-finger protein 3, RNF30, tripartite motif containing 54, tripartite motif-containing 54
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Symbols: TRIM54
• Immunogen: Synthetic peptides corresponding to TRIM54(tripartite motif-containing 54) The peptide sequence was selected from the N terminal of TRIM54. Peptide sequence NFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCA.
• Quantity: 100 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 57159
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG