Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MYL9 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

$152.22 - $436.00

Specifications

Antigen MYL9
Concentration LYOPH
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15538320
View Documents
Novus Biologicals
NBP15538320UL
20 μL
Each for $152.22
Add to cart
 
NBP155383
View Documents
Novus Biologicals
NBP155383
100 μL
Each for $436.00
Add to cart
 
Description

Description

MYL9 Polyclonal specifically detects MYL9 in Human, Mouse samples. It is validated for Western Blot.
Specifications

Specifications

MYL9
Western Blot
Unconjugated
RUO
P24844
10398
Synthetic peptides corresponding to MYL9(myosin, light chain 9, regulatory) The peptide sequence was selected from the middle region of MYL9. Peptide sequence FDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEF.
Primary
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
20 kDa
LYOPH
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
LC2020 kDa myosin light chain, MLC2Myosin RLC, MRLC1MLC-2C, myosin regulatory light chain 1, Myosin regulatory light chain 2, smooth muscle isoform, Myosin regulatory light chain 9, Myosin regulatory light chain MRLC1, myosin regulatory light polypeptide 9, myosin, light chain 9, regulatory, myosin, light polypeptide 9, regulatory, MYRL2MGC3505
MYL9
IgG
Affinity Purified
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit