Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MYL9 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$152.22 - $436.00
Specifications
| Antigen | MYL9 |
|---|---|
| Concentration | LYOPH |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15538320
|
Novus Biologicals
NBP15538320UL |
20 μL |
Each for $152.22
|
|
NBP155383
|
Novus Biologicals
NBP155383 |
100 μL |
Each for $436.00
|
|
Description
MYL9 Polyclonal specifically detects MYL9 in Human, Mouse samples. It is validated for Western Blot.Specifications
| MYL9 | |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P24844 | |
| 10398 | |
| Synthetic peptides corresponding to MYL9(myosin, light chain 9, regulatory) The peptide sequence was selected from the middle region of MYL9. Peptide sequence FDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEF. | |
| Primary | |
| Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution. | |
| 20 kDa |
| LYOPH | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| LC2020 kDa myosin light chain, MLC2Myosin RLC, MRLC1MLC-2C, myosin regulatory light chain 1, Myosin regulatory light chain 2, smooth muscle isoform, Myosin regulatory light chain 9, Myosin regulatory light chain MRLC1, myosin regulatory light polypeptide 9, myosin, light chain 9, regulatory, myosin, light polypeptide 9, regulatory, MYRL2MGC3505 | |
| MYL9 | |
| IgG | |
| Affinity Purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title