MYPN Rabbit anti-Chinese Hamster, Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179809

Catalog No. NBP179809

Description

MYPN Polyclonal specifically detects MYPN in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MYPN
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_115967
• Gene Symbols: MYPN
• Immunogen: The immunogen for this antibody is MYPN. Peptide sequence PVPKVYWFKDGKQISKRNEHCKMRREGDGTCSLHIESTTSDDDGNYTIMA.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84665
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 145 kDa (MYOP), MYOP145 kDa sarcomeric protein, myopalladin
• Host Species: Rabbit
• Molecular Weight of Antigen: 145 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 78%.
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Chinese Hamster, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG