Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MYPN Rabbit anti-Chinese Hamster, Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen MYPN
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP179809
View Documents
Novus Biologicals
NBP179809
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

MYPN Polyclonal specifically detects MYPN in Human samples. It is validated for Western Blot.
Specifications

Specifications

MYPN
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
145 kDa (MYOP), MYOP145 kDa sarcomeric protein, myopalladin
MYPN
IgG
Affinity Purified
145 kDa
Western Blot
Unconjugated
RUO
NP_115967
84665
The immunogen for this antibody is MYPN. Peptide sequence PVPKVYWFKDGKQISKRNEHCKMRREGDGTCSLHIESTTSDDDGNYTIMA.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit