Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MYPN Rabbit anti-Chinese Hamster, Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | MYPN |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179809
|
Novus Biologicals
NBP179809 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
MYPN Polyclonal specifically detects MYPN in Human samples. It is validated for Western Blot.Specifications
| MYPN | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 145 kDa (MYOP), MYOP145 kDa sarcomeric protein, myopalladin | |
| MYPN | |
| IgG | |
| Affinity Purified | |
| 145 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_115967 | |
| 84665 | |
| The immunogen for this antibody is MYPN. Peptide sequence PVPKVYWFKDGKQISKRNEHCKMRREGDGTCSLHIESTTSDDDGNYTIMA. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title