Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ MYST3 Recombinant Protein Antigen
SDP

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Supplier:  Novus Biologicals™ NBP257745PEP

Catalog No. NBP257745PE


Add to Cart

Description

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYST3. Source: E.coli Amino Acid Sequence: KELEEQPTREDVKEEPGVQESFLDANMQKSREKIKDKEETELDSEEEQPSHDTSVVSEQMAGSEDDHEEDSHTKE The MYST3 Recombinant Protein Antigen is derived from E. coli. The MYST3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifications

Specifications

7994
MYST3 Recombinant Protein Antigen
PBS and 1M Urea, pH 7.4
EC 2.3.1.48, EC 3.1.26.4, histone acetyltransferase MYST3, KAT6A, MGC167033, MOZMonocytic leukemia zinc finger protein, MYST histone acetyltransferase (monocytic leukemia) 3, MYST-3, runt-related transcription factor binding protein 2, Runt-related transc
Unlabeled
100μL
Epigenetics
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52841. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
>80% by SDS-PAGE and Coomassie blue staining
Store at −20°C. Avoid freeze-thaw cycles
Blocking/Neutralizing, Control
KAT6A
Recombinant Protein Antigen
RUO
E.coli
Recommendations

Recommendations

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For research use only.